By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
Live Trading NewsLive Trading NewsLive Trading News
  • Stocks
  • Forex
  • Gold
  • KNIGHTS
  • Luxury
  • Horse Racing
  • Trade Now
Search
Reading: Vegan Air Fryer Falafel
Share
Live Trading NewsLive Trading News
  • Stocks
  • Forex
  • Gold
  • KNIGHTS
  • Luxury
  • Horse Racing
  • Trade Now
Search
  • Stocks
  • Forex
  • Gold
  • KNIGHTS
  • Luxury
  • Horse Racing
  • Trade Now
Follow US
© 2024 LiveTradingNews.com - All Rights Reserved.
Live Trading News > Blog > Health > Coach Bee > Vegan Air Fryer Falafel
Coach Bee

Vegan Air Fryer Falafel

Ivy Heffernan
Last updated: May 9, 2021 8:46 am
Ivy Heffernan
Share
2 Min Read
SHARE

From Coach Bee

It’s vegan! And it’s real high in protein!
I’ve made on my stories a couple of times and I’m always asked for the recipe! So here it is! I’m trying something different & decided to put the full recipe on my blog instead! So secret! So go check it! If you can’t tell already, I’m a huge advocate of an Air Fryer. If you don’t have one already! Get some!

* 1 can chickpeas, rinsed and drained
* 1 small onion, quartered
* 3 cloves garlic, roughly chopped
* 1/3 cup roughly chopped parsley
* 1/3 cup roughly chopped cilantro
* 1/3 cup chopped spring onion
* 1 teaspoon cumin
* 1/2 teaspoon sea salt
* 1/8 teaspoon crushed red pepper flakes (More if you like spicy)
* 1 teaspoon baking powder
* 4 tablespoons all purpose flour, plus more for dusting
* olive oil spray

Full list on my blog ➡️

https://bernsthehotnerd.com/2021/05/09/easy-air-fryer-falafel/

Other Air Fryer Recipes

View this post on Instagram

A post shared by Coach Bee🌶☀️💦 (@bernsthefitnerd)

View this post on Instagram

A post shared by Coach Bee🌶☀️💦 (@bernsthefitnerd)

Coach Bee (Bernice Chen) is a Life Consultant from Singapore residing in Bangkok, Thailand and the favored Personal Trainer/Lifestyle Consultant of many high profile locals. Coach Bee’s specialties include Fitness, Yoga, Strength, Nutrition, Design and Motivation.

Coach Bee creates bespoke agendas and environments for clients (Corporate/Individual) aimed at creating a better mind, body and soul.

Coach Bee has also been competing in a bodybuilding sub-division, Bikini Physique Shows since 2019 and has used her knowledge and experience to inspire her clients off the stage.

Health and fitness is all about balance, and harmony is her specialty.


#easyrecipes #easyairfryerrecipes #homemadefood #homemadecooking #easycooking #easymeals #easyvegan #highproteinlowcarb #highprotein #falafel #falafelrecipe

You Might Also Like

Catholics and Muslims in Israel: A Call for Greater Political Voice

Qatar’s Venture Capital Surge

The U.S. Dollar: Trump Cannot Save It—Buy Gold and Bitcoin

Quo Vadis: A Defining Moment in Church History

The Papal Tiara: A Crown of Earth and Heaven

TAGGED:easyairfryerrecipeseasycookingeasymealseasyrecipeseasyveganfalafelfalafelrecipehighproteinhighproteinlowcarbhomemadecookinghomemadefood

Sign Up For Daily Newsletter

Be keep up! Get the latest breaking news delivered straight to your inbox.

Subscribe our newsletter for latest news around the world. Let's stay updated!

By signing up, you agree to our Terms of Use and acknowledge the data practices in our Privacy Policy. You may unsubscribe at any time.
Share This Article
Facebook Twitter Copy Link Print
Share
By Ivy Heffernan
Executive Assistant for KXCO. 4+ years in rigorous marketing positions. Experienced writer, and part time digital designer. Thorough experience in web design and SEO. Early crypto investor and enthusiast. Entrepreneurial mindset with a degree in Business Economics
Previous Article China Economic Update
Next Article F1: Spanish Grand Prix Race Results


Latest News

Founders Pitching and Power Networking with SEA Region Decision Markers
Featured Headline News KXCO Guide May 6, 2025
How to Protect Your Portfolio Against Global De-Dollarization
America Asia China China Stocks Headline News Middle East Most Popular Opinion Shayne Heffernan Shayne Heffernan Start Ups Stocks May 6, 2025
Target150 Stem Cell Therapy and Wellness in Thailand
Featured Headline News Lifestyle Lifestyles of the RIch and Famous Living Luxury Most Popular Thailand May 6, 2025
The End of the Dollar Is Nigh
Asia Crypto Economy Headline News May 6, 2025

Stay Connected

235.3kFollowersLike
69.1kFollowersFollow
11.6kFollowersPin
56.4kFollowersFollow
4.4kFollowersFollow
//

Stay informed with LiveTradingNews.com – your ultimate destination for timely and insightful updates on global markets, finance, and investment trends. Explore the latest news and analysis to empower your trading decisions.

Quick Link

  • About us
  • Advertise
  • Send us a tip!
  • Privacy Policy
  • Contact us

Top Categories

  • Knightsbridge Insights
  • Featured
  • Stocks
  • Shayne Heffernan
  • Lifestyle

Sign Up for Our Newsletter

Subscribe to our newsletter to get our newest articles instantly!

Subscribe our newsletter for latest news around the world. Let's stay updated!

Live Trading NewsLive Trading News
Follow US
© 2025 LiveTradingNews - For The Traders, By The Traders – All Right Reserved By Knightsbridge Group
Welcome Back!

Sign in to your account

Register Lost your password?